Protein Info for UW163_RS07825 in Ralstonia solanacearum UW163

Annotation: two-component sensor histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 442 transmembrane" amino acids 21 to 43 (23 residues), see Phobius details amino acids 49 to 72 (24 residues), see Phobius details amino acids 79 to 98 (20 residues), see Phobius details amino acids 105 to 125 (21 residues), see Phobius details amino acids 129 to 150 (22 residues), see Phobius details amino acids 156 to 176 (21 residues), see Phobius details PF00512: HisKA" amino acids 222 to 283 (62 residues), 31.2 bits, see alignment E=2.7e-11 PF02518: HATPase_c" amino acids 330 to 441 (112 residues), 79.8 bits, see alignment E=3.1e-26 PF14501: HATPase_c_5" amino acids 334 to 429 (96 residues), 23.8 bits, see alignment E=5.4e-09

Best Hits

KEGG orthology group: None (inferred from 99% identity to rsc:RCFBP_10714)

Predicted SEED Role

"Signal transduction histidine kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (442 amino acids)

>UW163_RS07825 two-component sensor histidine kinase (Ralstonia solanacearum UW163)
MTIARHQDYRHEVSDFRLASSRGGVITGAALVLLGIGLDYGLYPQHLAMFSAVRIIVSAL
MLTTLVCLAASWGRAHVQGLTLLWLALPQIMIVWMIQHTDGAESLYYAGLNLAIFAVGIV
LPLGFIQTVLFGAFTYIIWVIACVMHTGGIQSRGTFIVHSLFILFSVTACAVYTYFNERG
RFQLFLLKEELAEKNEQLEAINHSLTEIKGQLLQQEKMVAIGTLSAGLLHEINNPVNFCL
MAIAVAQEDTTAKASPMLLECLADAKEGMQRVQHIVSDLKTFAYRSPEKGETDTPFLVEK
AIDSAIRLTSHELRGVEVNRQLPPDTLVRGDEAAIIGVLINLLSNAALAMHKAQRENPRI
DVSAEWQNGRLFVVVTDNGPGIAEKNLSRVFEPFFTTREVGKGLGLGLSISYSVIQHHGG
TLSVASQEGAWARFTFDLPRAE