Protein Info for UW163_RS07745 in Ralstonia solanacearum UW163

Annotation: 16S rRNA (uracil(1498)-N(3))-methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 249 TIGR00046: RNA methyltransferase, RsmE family" amino acids 4 to 247 (244 residues), 173.8 bits, see alignment E=1.9e-55 PF20260: PUA_4" amino acids 20 to 64 (45 residues), 44.7 bits, see alignment 1.2e-15 PF04452: Methyltrans_RNA" amino acids 74 to 242 (169 residues), 172.4 bits, see alignment E=6e-55

Best Hits

KEGG orthology group: K09761, ribosomal RNA small subunit methyltransferase E [EC: 2.1.1.-] (inferred from 95% identity to rsl:RPSI07_0746)

Predicted SEED Role

"Ribosomal RNA small subunit methyltransferase E (EC 2.1.1.-)" in subsystem Heat shock dnaK gene cluster extended (EC 2.1.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (249 amino acids)

>UW163_RS07745 16S rRNA (uracil(1498)-N(3))-methyltransferase (Ralstonia solanacearum UW163)
MGLPRFYIDSPLAPHTTVTLPESVARHIHVLRLAVGDDVQLFDGSGLEFRARLDAINRRD
ATASLADATQPDTEARYAITLAQGIAGGDKMDWLIEKAVELGVHAIAPLQTERGVVRLSG
ERAAKRVQHWQALVQAACEQCGRARVPAVSPVTTLRDWLTAAKASGRARIMLSPRGSQSL
TQWAAQSRERIDSTGIELLIGPEGGLSPDEESLAEAAGYLPLTLGRRILRTESAALVAVS
ALHAVLGEF