Protein Info for UW163_RS07120 in Ralstonia solanacearum UW163

Annotation: indole-3-glycerol phosphate synthase TrpC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 267 PF00218: IGPS" amino acids 5 to 264 (260 residues), 318.7 bits, see alignment E=1.2e-99

Best Hits

Swiss-Prot: 98% identical to TRPC1_RALSO: Indole-3-glycerol phosphate synthase 1 (trpC1) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K01609, indole-3-glycerol phosphate synthase [EC: 4.1.1.48] (inferred from 100% identity to rsc:RCFBP_10572)

Predicted SEED Role

"Indole-3-glycerol phosphate synthase (EC 4.1.1.48)" in subsystem Tryptophan synthesis (EC 4.1.1.48)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.1.1.48

Use Curated BLAST to search for 4.1.1.48

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (267 amino acids)

>UW163_RS07120 indole-3-glycerol phosphate synthase TrpC (Ralstonia solanacearum UW163)
MSDILQKILAVKAEEVAAARKHRDLPSVRAEAEANRHDSTLGPRGFAQALRDKIGAGQAA
VIAEVKKASPSKGVLRPDFKPAEIAGSYAEHGAACLSVLTDEQFFQGHADYLREARAACA
LPVLRKDFMVDLYQVYEARSWGADCILLIVSALDQGLMAELEACTHELGMDVLVEVHDGH
ELDRALRLSTPLVGVNNRNLRTFETTLDTTLGLLKHMPDDRIVVTESGILKPDDVRKMRV
ADVNAFLVGEAFMRADDPGAELARLFA