Protein Info for UW163_RS06860 in Ralstonia solanacearum UW163

Annotation: iron ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 380 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details PF13531: SBP_bac_11" amino acids 62 to 319 (258 residues), 50.8 bits, see alignment E=4.8e-17 PF01547: SBP_bac_1" amino acids 66 to 316 (251 residues), 55.7 bits, see alignment E=2.1e-18 PF13416: SBP_bac_8" amino acids 76 to 332 (257 residues), 56.6 bits, see alignment E=9.1e-19 PF13343: SBP_bac_6" amino acids 152 to 331 (180 residues), 35.8 bits, see alignment E=1.6e-12

Best Hits

KEGG orthology group: K02012, iron(III) transport system substrate-binding protein (inferred from 99% identity to rsc:RCFBP_10517)

Predicted SEED Role

"ABC-type Fe3+ transport system, periplasmic component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (380 amino acids)

>UW163_RS06860 iron ABC transporter substrate-binding protein (Ralstonia solanacearum UW163)
MPSIPDTRRRWLCQAAALLAAGGLAAAESPAQWLGRPAPELPSYYPRDYGVVFDAARREG
RVTVYSTTDFAAAHPLIRAFEARYPGVTVDYREQNSDDLYRRYLAELASGAPGADVVWSS
SMPEQFKLVNDGHALPYASPERPYLPSWAIWKNEAYGTSYEPVVFVYNARQLPADLVPAT
HADFARILTVHRDLLRGRVASYDIEHSGSAFLFAAEDARTTPVFWDVARALGAANVNLYI
TTAAMLERVASGESLLAYNVIGSYAARYADRNPALAIKMPADYTLVATRVAFIARRSTHP
NAARLWLDFVLSREGQSVMANRAFLFSLRQDVETGLTAKRLLAELGNTHRPIPVGPGLLA
HQDQLRRADFLKRWHAALGR