Protein Info for UW163_RS06750 in Ralstonia solanacearum UW163

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 262 transmembrane" amino acids 29 to 52 (24 residues), see Phobius details amino acids 59 to 82 (24 residues), see Phobius details amino acids 112 to 139 (28 residues), see Phobius details amino acids 145 to 169 (25 residues), see Phobius details amino acids 178 to 198 (21 residues), see Phobius details amino acids 231 to 253 (23 residues), see Phobius details PF01061: ABC2_membrane" amino acids 15 to 225 (211 residues), 129.5 bits, see alignment E=1.3e-41 PF12698: ABC2_membrane_3" amino acids 63 to 251 (189 residues), 49 bits, see alignment E=4.9e-17

Best Hits

Swiss-Prot: 37% identical to YADH_ECO57: Inner membrane transport permease YadH (yadH) from Escherichia coli O157:H7

KEGG orthology group: K09686, antibiotic transport system permease protein (inferred from 98% identity to rsc:RCFBP_10495)

Predicted SEED Role

"ABC-type multidrug transport system, permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (262 amino acids)

>UW163_RS06750 ABC transporter permease (Ralstonia solanacearum UW163)
MSAIPQIRPGRWIGFRTLLYKEVLRFWKVSFQTVAAPVLTALLYLMIFGHVLEDHVQVFG
QIGYTAFLIPGLVMMSVLQNAFANSSSSLIQSKITGNLVFIMLPPLSDWEMFGAYVVASV
LRGLAVGAGVLAVTAWFAHLHFAQPLWIIVFAILGAAVLGTLGLIAGIWAEKFDQLAAFQ
NFLIVPATFLAGVFYSIHSLPPFWQAVSHANPFFYMIDGFRYGFFGVSDVPVAISLGVMV
IALVVVGGIALQMLRTGYKLRH