Protein Info for UW163_RS06590 in Ralstonia solanacearum UW163

Annotation: cytochrome c biogenesis protein ResB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 727 transmembrane" amino acids 22 to 47 (26 residues), see Phobius details amino acids 80 to 99 (20 residues), see Phobius details amino acids 176 to 194 (19 residues), see Phobius details amino acids 642 to 660 (19 residues), see Phobius details PF05140: ResB" amino acids 28 to 700 (673 residues), 489.9 bits, see alignment E=4.7e-151

Best Hits

KEGG orthology group: K07399, cytochrome c biogenesis protein (inferred from 98% identity to rsc:RCFBP_10464)

Predicted SEED Role

"Cytochrome c-type biogenesis protein Ccs1/ResB" in subsystem Biogenesis of c-type cytochromes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (727 amino acids)

>UW163_RS06590 cytochrome c biogenesis protein ResB (Ralstonia solanacearum UW163)
MSSVSTSGVRIHSRRRALRETVELLSSMRFAISLLTVIAIASVIGTVLKQNEPYPNYVNQ
FGPFWADVFRALTLPTVYSAWWFLLILAFLVVSTSLCIVRNAPKMLADMRVWREHVREGS
LRAFHHKDEFDAPTEAAAVTARLAALAQNRGFRIRAFARDGGATLITAKAGAGNKIGYVL
AHAAIVIICIGGLLDGDMMIRLQMWFGGKSPIKGNAVISQIGPEHRLPVSNPGFRGNAFV
PEGATVGTAILNIGDGALIQDLPFSVTLKKFTVEHYSTGMPKLFASDIVVTDRRTGKQTD
ARVEVNKPFVYDGIAIYQSSFEDGGSRLKLAGFPMRGADAKTFALSGTVGENTRLAGPGA
DYTVEFTDFRLMNIETITDASGKQDARGVGKGGGDTGLRAELGNATRMTRERELRNVGPS
VQYKLRDANGQAREFSNYMLPVTLDGQSVFLAGVRTQPDEPFRYLRIPADAQGTVNDWMR
LRAALQSSAMRGEAARRFALLSMPGDDRAVLRAQLAESARRALDLFAGATDIKGAPADGQ
GGFAAVAGFLQKSVPEGEREKAADVLMKIINSAMWELWQLARTQDGLAVPSVDAASSQWL
QTAINSLSDSFFYAAPVYLQLVDFQQVQASVFQLTRAPGKNIVYLGSLLLVLGVFSMFYV
RERRWWLWIRPQAGGSAHGAHVLTAMSTARRTLDFDREFERLKQDVRAAAGAPGSATAAA
AEQTPTK