Protein Info for UW163_RS06455 in Ralstonia solanacearum UW163

Annotation: 50S ribosomal protein L22

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 109 TIGR01044: ribosomal protein uL22" amino acids 5 to 106 (102 residues), 142.6 bits, see alignment E=2.3e-46 PF00237: Ribosomal_L22" amino acids 5 to 107 (103 residues), 131.4 bits, see alignment E=6.7e-43

Best Hits

Swiss-Prot: 99% identical to RL22_CUPTR: 50S ribosomal protein L22 (rplV) from Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CIP 107171 / LMG 19424 / R1)

KEGG orthology group: K02890, large subunit ribosomal protein L22 (inferred from 98% identity to rso:RSc3014)

MetaCyc: 62% identical to 50S ribosomal subunit protein L22 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"LSU ribosomal protein L22p (L17e)" in subsystem Ribosome LSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (109 amino acids)

>UW163_RS06455 50S ribosomal protein L22 (Ralstonia solanacearum UW163)
MEVKAIHRGARISAQKTRLVADQIRGLPIERALNVLTFSPKKAAGIVKKVVESAIANAEH
NEGADIDELKVKSIYIDKATSLKRFTARAKGRGNRIEKQTCHITVTLGN