Protein Info for UW163_RS06190 in Ralstonia solanacearum UW163

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 429 transmembrane" amino acids 51 to 77 (27 residues), see Phobius details amino acids 84 to 106 (23 residues), see Phobius details amino acids 115 to 140 (26 residues), see Phobius details amino acids 161 to 179 (19 residues), see Phobius details amino acids 185 to 207 (23 residues), see Phobius details amino acids 236 to 254 (19 residues), see Phobius details amino acids 274 to 291 (18 residues), see Phobius details amino acids 303 to 324 (22 residues), see Phobius details amino acids 336 to 356 (21 residues), see Phobius details amino acids 368 to 389 (22 residues), see Phobius details amino acids 399 to 417 (19 residues), see Phobius details PF00083: Sugar_tr" amino acids 17 to 218 (202 residues), 82.8 bits, see alignment E=2.5e-27 amino acids 213 to 423 (211 residues), 42.7 bits, see alignment E=3.8e-15 PF07690: MFS_1" amino acids 19 to 368 (350 residues), 103.4 bits, see alignment E=1.2e-33

Best Hits

Swiss-Prot: 64% identical to CITA_SALTI: Citrate-proton symporter (citA) from Salmonella typhi

KEGG orthology group: None (inferred from 100% identity to rsc:RCFBP_10388)

MetaCyc: 64% identical to propane-1,2,3-tricarboxylate-proton symporter (Salmonella enterica enterica serovar Typhimurium str. LT2)
RXN1R65-49

Predicted SEED Role

"Permeases of the major facilitator superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (429 amino acids)

>UW163_RS06190 MFS transporter (Ralstonia solanacearum UW163)
MHTHNPNESKARSIFRVVSGNFLEMYDFMVYGYYAKAIADTFFPADNEFLSLMLSLVTFG
VGFLMRPLGALILGAYIDRHGRRAGLIVTLGLMACGTLLIALVPGYNTIGLAAPLLVLIG
RLLQGFSAGVELGGVSVYLAEISTPGRKGFFVSWQSASQQVAVMFAALLGVLLSFQLSPK
EMGEWGWRVPFLVGCLIVPFLFIIRRSLQETEEFKQRKHRPALGEIFRSMGENWRLVGAG
TLLVVMTTVSFYLITAYTPTFGKSVLHLSNLDSLIVTLCVGASNFFWLPVMGSVSDRIGR
RPLLITFTALTLLTAYPAMQWLIAEPSFGRLLAVELWLSFLYGSYNGAMVVTLTEIMPPA
VRTTGFSLAYSLATAIFGGFTPAIATWLIHATGNKAMPGLWLSFAAICGLVATLIVVKPA
GRHVHTVTA