Protein Info for UW163_RS06105 in Ralstonia solanacearum UW163

Annotation: cation transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 386 transmembrane" amino acids 23 to 42 (20 residues), see Phobius details amino acids 50 to 68 (19 residues), see Phobius details amino acids 90 to 111 (22 residues), see Phobius details amino acids 123 to 146 (24 residues), see Phobius details amino acids 167 to 184 (18 residues), see Phobius details amino acids 190 to 209 (20 residues), see Phobius details TIGR01297: cation diffusion facilitator family transporter" amino acids 19 to 300 (282 residues), 212.4 bits, see alignment E=4e-67 PF01545: Cation_efflux" amino acids 23 to 216 (194 residues), 157.7 bits, see alignment E=3.1e-50 PF16916: ZT_dimer" amino acids 220 to 299 (80 residues), 65.1 bits, see alignment E=5e-22

Best Hits

KEGG orthology group: None (inferred from 97% identity to rsc:RCFBP_10372)

Predicted SEED Role

"Cobalt-zinc-cadmium resistance protein" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (386 amino acids)

>UW163_RS06105 cation transporter (Ralstonia solanacearum UW163)
MTSSTPPAIPADIRRQHAERTTLVSAAVNCALSAGQIAAGLWSHSQGLVADGLHTLSDLI
ADGIVFIANRNSHKGPDEDHQYGHARYENAASLGLGLLLLAAGAGMIWAALESLRAPHGP
APVHGLALWVALTALAAKEGLFRYMLAVARRIGSRMLIANAWHARSDAVSSLVAAVGVAG
NLMGFRWLDPVAACVVGAMIGRVGIRFGWEALNDLMDRALPPSQVQAIHASLAATPGVIN
VHDLRTRVTGDQALVDAHIEVDPRVSVSEGHAIAVRARTNVLAAHTAMAVLDVQLHVDPR
ERVYTDPLPLPDRDALCAVLAQALPPGTPLDARHCLLHYVEGGVDVDLVLSPSLADHAAQ
VAEIVRARWHGLVRLRVLTVAPGAAA