Protein Info for UW163_RS05920 in Ralstonia solanacearum UW163

Annotation: type II secretion system protein GspH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 165 transmembrane" amino acids 20 to 39 (20 residues), see Phobius details PF07963: N_methyl" amino acids 12 to 36 (25 residues), 33.1 bits, see alignment 2.9e-12 TIGR01708: type II secretion system protein H" amino acids 14 to 149 (136 residues), 74 bits, see alignment E=1.2e-24 TIGR02532: prepilin-type N-terminal cleavage/methylation domain" amino acids 14 to 36 (23 residues), 31 bits, see alignment (E = 1.5e-11) PF12019: GspH" amino acids 52 to 156 (105 residues), 36.3 bits, see alignment E=7e-13

Best Hits

KEGG orthology group: K02457, general secretion pathway protein H (inferred from 95% identity to rsl:RPSI07_0380)

Predicted SEED Role

"General secretion pathway protein H"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (165 amino acids)

>UW163_RS05920 type II secretion system protein GspH (Ralstonia solanacearum UW163)
MQHRSAPHCAARMRRGFTLLELLVVVVIIGIVLGVVAVNATPNPRSQLADDAQKLARLIE
LAQEEAQLTARPVAWEGDAQGWRFLEATPGGWRVMTRDVLAPGHWRQPMDNVQIVAGAAA
VTGAPQRLVFGREAIGLPWRVALSSRGARIDVVSDGGPRVLTEAP