Protein Info for UW163_RS05900 in Ralstonia solanacearum UW163

Annotation: general secretion pathway protein GspL

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 479 transmembrane" amino acids 326 to 349 (24 residues), see Phobius details PF05134: T2SSL" amino acids 5 to 315 (311 residues), 174.3 bits, see alignment E=2.8e-55 PF12693: GspL_C" amino acids 320 to 477 (158 residues), 125.6 bits, see alignment E=1.7e-40

Best Hits

KEGG orthology group: K02461, general secretion pathway protein L (inferred from 96% identity to rsc:RCFBP_10326)

Predicted SEED Role

"General secretion pathway protein L"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (479 amino acids)

>UW163_RS05900 general secretion pathway protein GspL (Ralstonia solanacearum UW163)
MTTSLYVRLPHRPIQSPERWSQGALASVPFALVREEGAQGPQRILRDGTSRIDELPAADR
LVLLLPAADVLLVPASVPPLALPKLRLALPNLVEERLVQDAQQCHIALGPRLGAASAHGW
RAPREPQARALMIADRAWIRFVLDSVAGHKHRNCHLLPAQLCLPLEAAAPVAGDIGKAQA
AQAHTEPSFEPAGAEAASADALAEAASPATAAVTTIALDAAPPSDPDAPPAVDITVHSGP
AEGYGLRVLPAHVADWLAIAPVPARLMVAPALRDLAPALSTDPAAARLDWAVWAAGARAA
LSAGDADLCQFDFAHGGIAGMDWSAWRLPVALAALIVAVQLIGMNTQWLTLRAEQKRLDA
AMRSQLQTAFPNTPVILDPPAQMRRQVQQLRLAAGKSAPEDFLPLADRFAQAAAGLAPDA
LLALDYHGRALVVTLKEGTDTTMLRTAAATVGLKMETAEAPRGGEATVPGSRWTVSIAQ