Protein Info for UW163_RS05780 in Ralstonia solanacearum UW163

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 416 transmembrane" amino acids 15 to 39 (25 residues), see Phobius details amino acids 51 to 70 (20 residues), see Phobius details amino acids 82 to 100 (19 residues), see Phobius details amino acids 106 to 129 (24 residues), see Phobius details amino acids 141 to 160 (20 residues), see Phobius details amino acids 171 to 189 (19 residues), see Phobius details amino acids 222 to 245 (24 residues), see Phobius details amino acids 257 to 275 (19 residues), see Phobius details amino acids 287 to 304 (18 residues), see Phobius details amino acids 310 to 330 (21 residues), see Phobius details amino acids 342 to 365 (24 residues), see Phobius details amino acids 373 to 394 (22 residues), see Phobius details PF07690: MFS_1" amino acids 23 to 307 (285 residues), 58.9 bits, see alignment E=2.1e-20

Best Hits

KEGG orthology group: None (inferred from 97% identity to rsc:RCFBP_10303)

Predicted SEED Role

"Nucleoside ABC transporter, permease protein 1"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (416 amino acids)

>UW163_RS05780 MFS transporter (Ralstonia solanacearum UW163)
MTPLLSPDSPDGRRLVLLLGLAQTVSWGTLYFTFTVFLAPMHGTLGWARPFLAGGFSLGL
LVWALCSFLVGRTLDHWPARRVMGAGSALAAASLLAWSLADNKTAFLLLWLPMGMAMATT
LYDPAFVVLRQTFGDAYQRPIVGLTLIAGFASTICIPLAQWGVEHIGWRHTLQAFALLHL
LVCLPIHARLRVRPPAQAMAGPAAAAAPVTPSAWRMALRMPVFWAVVLAFVAVNLVASML
GAHLIPLLSEKGVSTARQLLIAALIGPAQVLGRLAMMRLRFAHPVRIAPFTYTAMAAALA
MLALSSGPLLLVSAVLYGAANGINTMLRAIAMPELVSRAQYATLNGLMMTPVLLAQASGP
WLGALLWKATGGYATVEWAMVGAALIAVAAFAHGLRHARASTTHADAERRHVTQAR