Protein Info for UW163_RS05755 in Ralstonia solanacearum UW163

Annotation: NAD(P)-dependent oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 262 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details PF00106: adh_short" amino acids 8 to 195 (188 residues), 159.5 bits, see alignment E=1.5e-50 PF08659: KR" amino acids 11 to 166 (156 residues), 48.2 bits, see alignment E=2.5e-16 PF13561: adh_short_C2" amino acids 16 to 257 (242 residues), 160.5 bits, see alignment E=1.1e-50

Best Hits

Swiss-Prot: 50% identical to YVAG_BACSU: Uncharacterized oxidoreductase YvaG (yvaG) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 98% identity to rsc:RCFBP_10297)

Predicted SEED Role

"PROBABLE OXIDOREDUCTASE PROTEIN( EC:1.- )"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (262 amino acids)

>UW163_RS05755 NAD(P)-dependent oxidoreductase (Ralstonia solanacearum UW163)
MDLRLQNKLALVTGSTKGIGHAIAVALAAEGARVILNGRTDASVAEAVSRLLAEAPGAHV
EAFAGDLSDPAQAEALAARFPRVDILVNNLGIFDPKPFEDIDDAEWLRFFNVNVMSGVRL
SRAYLPGMKAQNWGRIVFISSESGVQIPAEMVHYGVTKTALLGLSRGLAELCAGTAVTVN
AVLPGPTRSEGVETFTRKLSGGQRFEAFEKTFFETARPTSLIKRFATPQEVASLVAYVAS
PLSAATTGAALRVDGGVVKSAF