Protein Info for UW163_RS04895 in Ralstonia solanacearum UW163

Annotation: potassium transporter Kef

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 407 transmembrane" amino acids 20 to 40 (21 residues), see Phobius details amino acids 47 to 65 (19 residues), see Phobius details amino acids 71 to 90 (20 residues), see Phobius details amino acids 102 to 122 (21 residues), see Phobius details amino acids 128 to 148 (21 residues), see Phobius details amino acids 168 to 186 (19 residues), see Phobius details amino acids 193 to 214 (22 residues), see Phobius details amino acids 230 to 246 (17 residues), see Phobius details amino acids 249 to 250 (2 residues), see Phobius details amino acids 252 to 267 (16 residues), see Phobius details amino acids 277 to 298 (22 residues), see Phobius details amino acids 303 to 328 (26 residues), see Phobius details amino acids 340 to 357 (18 residues), see Phobius details amino acids 369 to 391 (23 residues), see Phobius details PF00999: Na_H_Exchanger" amino acids 23 to 349 (327 residues), 87.4 bits, see alignment E=4.7e-29

Best Hits

KEGG orthology group: None (inferred from 99% identity to rsc:RCFBP_10169)

Predicted SEED Role

"Kef-type K+ transport systems, membrane components"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (407 amino acids)

>UW163_RS04895 potassium transporter Kef (Ralstonia solanacearum UW163)
MSAMTGLHDLFPSWPPAPGGLFWIGLALVGAALCGEFARVLLRLPRIVGYAVAGLAAGVL
GRPLIDADMLGETHILIEMALALALFELGHRLSFDWLRANRWLLLTSAFESVLTWGLVTW
LLQAFGVAVPVAVAAGAIAVATSPTVLLQLKNELRAEGQVTERLLSMGALNSIYAGVLVP
LTAGWLHSEYGHWGAALLHPLYLLAGSVLMAWVMGKAGHALYHRMAGDDHYAFLVLVGLV
LFTLALTKLLKLSVPLTLLLAGVVFKHQDAHPRVWPTHFGSAGSILIVVMIVSLGLPLGA
SDWMIGGVAAVVLVLARFVAKLAGTAALGSFSGLSMRQSVALGLALGPMSGLSWLLMHDT
AVLYPQTGGPLSAIILCTLAIQQIAAPILTARALRWAGEVRQEEGRR