Protein Info for UW163_RS04610 in Ralstonia solanacearum UW163

Annotation: phenylalanine 4-monooxygenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 313 TIGR01267: phenylalanine-4-hydroxylase" amino acids 42 to 286 (245 residues), 385.8 bits, see alignment E=3.5e-120 PF00351: Biopterin_H" amino acids 48 to 267 (220 residues), 160.6 bits, see alignment E=2.6e-51

Best Hits

Swiss-Prot: 93% identical to PH4H_RALSO: Phenylalanine-4-hydroxylase (phhA) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K00500, phenylalanine-4-hydroxylase [EC: 1.14.16.1] (inferred from 99% identity to rsc:RCFBP_10110)

MetaCyc: 73% identical to phenylalanine hydroxylase (Chromobacterium violaceum)
Phenylalanine 4-monooxygenase. [EC: 1.14.16.1]

Predicted SEED Role

"Phenylalanine-4-hydroxylase (EC 1.14.16.1)" in subsystem Aromatic amino acid degradation or Pterin biosynthesis (EC 1.14.16.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.16.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (313 amino acids)

>UW163_RS04610 phenylalanine 4-monooxygenase (Ralstonia solanacearum UW163)
MAIAPTASAAPSPAPAGFTGTLTDKLREQFADGLDGQTLRPDFTIEQPVHRYTAADHATW
RTLYDRQEALLPGRVCEEFLQGLTTLGMRRESVPSFDQLNETLMRATGWQIVAVPGLVPD
EVFFEHLANRRFPASWWMRRPDQLDYLQEPDCFHDIFGHVPLLINPIFADYMQAYGQGGL
KAARLGALDMLARLYWYTVEFGLIRTPAGLRIYGAGIVSSKSESVYALDSASPNRIGFDV
RRIMRTRYRIDTFQKTYFVIDSFEQLFDATRPDFTPLYEELGRLPTFGAGDVADSDTVLN
AGTREDWGDTADA