Protein Info for UW163_RS04080 in Ralstonia solanacearum UW163

Annotation: DNA-binding response regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00072: Response_reg
  • amino acids 8 to 118 (111 residues), 88 bits, E=7.3e-29
• PF08281: Sigma70_r4_2
  • amino acids 147 to 191 (45 residues), 26.5 bits, 6e-10
• PF00196: GerE
  • amino acids 148 to 203 (56 residues), 61.2 bits, E=8.9e-21

Best Hits

Swiss-Prot: 36% identical to NREC_STAAW: Oxygen regulatory protein NreC (nreC) from Staphylococcus aureus (strain MW2)

KEGG orthology group: None (inferred from 99% identity to rsc:RCFBP_21425)

MetaCyc: 36% identical to DNA-binding transcriptional dual regulator NarL (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"DNA-binding response regulator, LuxR family"

Protein Sequence (210 amino acids)

>UW163_RS04080 DNA-binding response regulator (Ralstonia solanacearum UW163)
MNMPVKLLLVDDHPLVRDGVRVRLEAVPHFQVVGEAGDADGALQAARALSPDLALMDIGM
RGMNGIALTEKFGEQFPEIAVLVLSMHDNLEYVRQVMRAGARGYVLKDAPASELVEAIDA
VLAGRPFYSAQLAMRMAEQAVAPTPVEALTPREHDILDGVAQGWSNKRIADELGLSVRTV
ESHRLNLKRKLGIEGQAELVKFAVEAGKER