Protein Info for UW163_RS03910 in Ralstonia solanacearum UW163

Annotation: class I SAM-dependent rRNA methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF17785: PUA_3
  • amino acids 4 to 67 (64 residues), 74.5 bits, E=1.6e-24
• PF02475: Met_10
  • amino acids 126 to 271 (146 residues), 27.2 bits, E=1.1e-09
• PF10672: Methyltrans_SAM
  • amino acids 179 to 366 (188 residues), 99.8 bits, E=5.7e-32
• PF05175: MTS
  • amino acids 214 to 337 (124 residues), 24.3 bits, E=7.8e-09
• PF03602: Cons_hypoth95
  • amino acids 221 to 309 (89 residues), 33.2 bits, E=1.5e-11
• PF13847: Methyltransf_31
  • amino acids 222 to 356 (135 residues), 30.7 bits, E=8.9e-11
• PF09445: Methyltransf_15
  • amino acids 225 to 304 (80 residues), 26.8 bits, E=1.3e-09

Best Hits

Swiss-Prot: 51% identical to RLMI_SHEAM: Ribosomal RNA large subunit methyltransferase I (rlmI) from Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)

KEGG orthology group: K06969, ribosomal RNA large subunit methyltransferase I [EC: 2.1.1.-] (inferred from 98% identity to rsl:RPSI07_3327)

MetaCyc: 48% identical to 23S rRNA m5C1962 methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-11602 [EC: 2.1.1.191]

Predicted SEED Role

"LSU m5C1962 methyltransferase RlmI" in subsystem Ribosome biogenesis bacterial

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.- or 2.1.1.191

Protein Sequence (397 amino acids)

>UW163_RS03910 class I SAM-dependent rRNA methyltransferase (Ralstonia solanacearum UW163)
MQTLILKPGKERSLLRRHPWIFANAIDRAEGRPTSGATVVVRAHDGRFLARAAFSPTSQI
RARVWSFDEAEPVDHAFFKRRIAAAVAYRREWVRDTDAVRLVMGEADGLPGLIVDQYGTG
AAGQLVCQFSAAGVEHWKEAIVAALVKETGCPNVYERSDVSVREREGLPQLTGVLAGAEP
PADLSATEHGVRYYVDVREGHKTGFYVDQRDNRALVGALAKDRDVLNCFCYTGGFSLAAL
KGGARSVVSIDSSGEALAVAERNVTLNGFDAARAEWCDADVFKSLRNFRAEGRQFDLIVL
DPPKFAASAQQVDRAARAYKEINLVGLQLLRPGGLLFTYSCSGAIDADLFQKIVAGAAAD
ARVTARIQRRLSAGLDHPLLASFPEGEYLKGLLLQVG