Protein Info for UW163_RS03675 in Ralstonia solanacearum UW163

Annotation: bifunctional hydroxymethylpyrimidine kinase/phosphomethylpyrimidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 304 TIGR00097: hydroxymethylpyrimidine kinase/phosphomethylpyrimidine kinase" amino acids 20 to 282 (263 residues), 302.2 bits, see alignment E=1.3e-94 PF08543: Phos_pyr_kin" amino acids 27 to 281 (255 residues), 299.9 bits, see alignment E=1.3e-93 PF00294: PfkB" amino acids 100 to 256 (157 residues), 30 bits, see alignment E=3.6e-11

Best Hits

KEGG orthology group: K00941, hydroxymethylpyrimidine/phosphomethylpyrimidine kinase [EC: 2.7.1.49 2.7.4.7] (inferred from 97% identity to rsc:RCFBP_21346)

Predicted SEED Role

"Hydroxymethylpyrimidine phosphate kinase ThiD (EC 2.7.4.7)" (EC 2.7.4.7)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.49 or 2.7.4.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (304 amino acids)

>UW163_RS03675 bifunctional hydroxymethylpyrimidine kinase/phosphomethylpyrimidine kinase (Ralstonia solanacearum UW163)
MTITDPTLAIVAPASHVPRVLTIAGSDSGGGAGIQADLKTFAALGCYGMSAITAVTAQNT
LGVAAIESLTPDIVGAQIDAVAQDIGVDAAKTGMLGSPAVVEAIVSALARHPVAALVVDP
VMVSSSGAQLGSDATTQAMAKWLFPRALLVTPNLPEASALLGRPVLTADDMLPAARDLLT
LGPRAVLLKGGHLADVAIIGEDGVLQDVLVTADGTERIYTHTHIDTPHTHGTGCTLSAAI
AAHLARGEPLEAAVELSLDYLLHAIGAGRHLALGRGTGPLNHGFAPRPLAAPRAVEVDDG
DGFN