Protein Info for UW163_RS03605 in Ralstonia solanacearum UW163

Annotation: N-acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13302: Acetyltransf_3
  • amino acids 13 to 146 (134 residues), 32.5 bits, E=3.3e-11
• PF13673: Acetyltransf_10
  • amino acids 40 to 150 (111 residues), 33 bits, E=1.4e-11
• PF00583: Acetyltransf_1
  • amino acids 42 to 145 (104 residues), 47.8 bits, E=4.1e-16
• PF13508: Acetyltransf_7
  • amino acids 66 to 146 (81 residues), 41.4 bits, E=3.9e-14
• PF08445: FR47
  • amino acids 95 to 149 (55 residues), 30.4 bits, E=7.6e-11

Best Hits

KEGG orthology group: None (inferred from 98% identity to rsc:RCFBP_21332)

Predicted SEED Role

"Acetyltransferase, GNAT family (EC 2.3.1.-)" (EC 2.3.1.-)

KEGG Metabolic Maps

• 1- and 2-Methylnaphthalene degradation
• Alkaloid biosynthesis I
• Alkaloid biosynthesis II
• Anthocyanin biosynthesis
• Benzoate degradation via CoA ligation
• Biosynthesis of terpenoids and steroids
• Biosynthesis of type II polyketide backbone
• Biosynthesis of unsaturated fatty acids
• Butanoate metabolism
• Carotenoid biosynthesis - General
• Diterpenoid biosynthesis
• Ether lipid metabolism
• Ethylbenzene degradation
• Fatty acid biosynthesis
• Glycerophospholipid metabolism
• Glycosphingolipid biosynthesis - ganglio series
• Histidine metabolism
• Limonene and pinene degradation
• Lipopolysaccharide biosynthesis
• Lysine degradation
• Phenylalanine metabolism
• Tyrosine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.-

Protein Sequence (164 amino acids)

>UW163_RS03605 N-acetyltransferase (Ralstonia solanacearum UW163)
MPILEIDRPGAALRPVTQHDQPFLLSLYASTREAELRLTDWTDAQKQQFVRMQFDAQQHA
YFGYPDAEFFLILQDGAPAGRIYLQHRQDAILVIDVSLLPAFCGRGIGSAVLSAVFRLAA
QAGKRVQIHVERFNPAQRLYQRLGFRLVEDKGVYLFLEWGGVTA