Protein Info for UW163_RS03570 in Ralstonia solanacearum UW163

Annotation: surface antigen

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 501 signal peptide" amino acids 1 to 38 (38 residues), see Phobius details PF10282: Lactonase" amino acids 154 to 250 (97 residues), 39.6 bits, see alignment E=2e-14 amino acids 258 to 351 (94 residues), 36 bits, see alignment E=2.3e-13 amino acids 327 to 398 (72 residues), 34.6 bits, see alignment E=6.2e-13 amino acids 348 to 485 (138 residues), 62.7 bits, see alignment E=1.8e-21

Best Hits

KEGG orthology group: None (inferred from 94% identity to rsc:RCFBP_21325)

Predicted SEED Role

"surface antigen gene"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (501 amino acids)

>UW163_RS03570 surface antigen (Ralstonia solanacearum UW163)
MQPCPSGAPRVLHALPRQGMALALAATLSIGLSACGGGDDTTTATTASPPSNSVTPTPAP
APTPTPTPSPTPAPTPSPTPAPSPAPTYSVGGTVAGLGTGLSVKLLNNGGDAVTVSANGN
FKFPTALASGAKYAATVGTRPSGQQCTIANSSGTVGSANVSNIAVTCSARPLFAYAANSN
DNTVSAYTLDPTTGAPTLIGTPIPVGHGPLSLIADKAGKFVYVVDGNDNSVTTLAIDPET
GLLTVSGAPAATGAQPFNIARTPASTFAYTTNFGDNTLSGFSINATTGVLTSIGTVAAGT
NPYTIAINKAGTFAYVVNAANGTGTPSAMVFSINGATGALTAVGSPVATGNAPFYIALHP
AGTFAYVANSQDNTVQVYAINTTTGVLTAVGSPVATGQGPIPIAVHPSGLFAYVGNVFDN
TVSLYAINTSTGALTLKSTLATGNDPLAITLNDAGSIAYIVNGVDHDVVAYKVDSSTGAL
TSVATAQTGLLPRAFAIVAVP