Protein Info for UW163_RS02850 in Ralstonia solanacearum UW163

Annotation: teicoplanin resistance protein VanZ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 408 transmembrane" amino acids 35 to 55 (21 residues), see Phobius details amino acids 75 to 94 (20 residues), see Phobius details amino acids 105 to 125 (21 residues), see Phobius details amino acids 139 to 159 (21 residues), see Phobius details amino acids 171 to 192 (22 residues), see Phobius details amino acids 248 to 267 (20 residues), see Phobius details amino acids 275 to 297 (23 residues), see Phobius details amino acids 307 to 326 (20 residues), see Phobius details amino acids 334 to 354 (21 residues), see Phobius details amino acids 377 to 395 (19 residues), see Phobius details PF04892: VanZ" amino acids 47 to 151 (105 residues), 39.8 bits, see alignment E=3.3e-14

Best Hits

KEGG orthology group: None (inferred from 98% identity to rsc:RCFBP_21174)

Predicted SEED Role

"Probable transmembrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (408 amino acids)

>UW163_RS02850 teicoplanin resistance protein VanZ (Ralstonia solanacearum UW163)
MGTSSVFPQLPPVTDLHAPPAAPSTHRHSPLARAGLAWFVLLVVYASLYPFSGWIDTGVS
PFAYLTAPLPRYNTLFDLLTNVWGYMPLGMLVVLSLHPRIAGWRAVLLAMLAGMLLSGAM
EAAQTYLPTRISSNVDLTANTVGALLGGIVMAPFAARLIDRGSLRRLRWRWFEPQATFAI
PLLLLWPFAQIFPQEFLFGMGGVVRSILLDPSPDAFLTGLIHSLFPGLFDWHDRLQAHPE
ALQRQELLEALITACSWVGTGLLATVAMRRGAPVLRLLAALLASALLVKAGATLLQFPAA
GAWDWLSSGGRFGLVVGSLVLVLLVRLPRWLRGALAMLLLLALIVLSNVLPPGPYSWVSA
QAWRLGRFVHFNSLSQWIGWVWPFLGVGYLAWRAELAQLQRRARRREA