Protein Info for UW163_RS02590 in Ralstonia solanacearum UW163

Annotation: protoheme IX farnesyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01473: protoheme IX farnesyltransferase
  • amino acids 22 to 299 (278 residues), 298 bits, E=4.6e-93
• PF01040: UbiA
  • amino acids 35 to 283 (249 residues), 217.7 bits, E=8.4e-69

Best Hits

Swiss-Prot: 97% identical to COXX_RALSO: Protoheme IX farnesyltransferase (ctaB) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K02301, protoheme IX farnesyltransferase [EC: 2.5.1.-] (inferred from 99% identity to rsc:RCFBP_21115)

Predicted SEED Role

No annotation

KEGG Metabolic Maps

• Biosynthesis of terpenoids and steroids
• Carotenoid biosynthesis - General
• Methionine metabolism
• Porphyrin and chlorophyll metabolism
• Riboflavin metabolism
• Terpenoid biosynthesis
• Tryptophan metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.-

Use Curated BLAST to search for 2.5.1.-

Protein Sequence (310 amino acids)

>UW163_RS02590 protoheme IX farnesyltransferase (Ralstonia solanacearum UW163)
MNTVASTSTSTQPSGWRHTASQYAALTKPRVTQLAVFCAVIGMFLATPGMVPWPVLIGGA
VGIWLFAGAAFAINCLVERKIDAMMRRTAWRPSASGELGTRQILVFSLVLGGAGMWTLHV
FANDLTMWLTFATFIGYAIIYTLLLKPATPQNIVIGGLSGAMPPALGWAAVANSVPAEAW
ILVLIIFTWTPPHFWALALYRRADYAKSGLPMLPITHGEKYTLLHILLYTLIMVAATILP
FVHGMSGYLYLAVALVLGFGFIAHAWRMYRSYSDALAQKTFRYSIVYLSVLFAALLIDHY
VKFGPRGAAL