Protein Info for UW163_RS02070 in Ralstonia solanacearum UW163

Annotation: acyl-CoA dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 595 transmembrane" amino acids 519 to 538 (20 residues), see Phobius details PF12418: AcylCoA_DH_N" amino acids 3 to 35 (33 residues), 50.6 bits, see alignment (E = 4.7e-17) PF02771: Acyl-CoA_dh_N" amino acids 41 to 158 (118 residues), 46 bits, see alignment E=1.9e-15 PF02770: Acyl-CoA_dh_M" amino acids 164 to 272 (109 residues), 48.7 bits, see alignment E=2.1e-16 PF00441: Acyl-CoA_dh_1" amino acids 283 to 451 (169 residues), 72.4 bits, see alignment E=1.4e-23 PF12806: Acyl-CoA_dh_C" amino acids 470 to 590 (121 residues), 121.8 bits, see alignment E=6e-39

Best Hits

KEGG orthology group: None (inferred from 99% identity to rsc:RCFBP_21011)

Predicted SEED Role

"Acyl-CoA dehydrogenase (EC 1.3.8.7)" (EC 1.3.8.7)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 1.3.8.7

Use Curated BLAST to search for 1.3.8.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (595 amino acids)

>UW163_RS02070 acyl-CoA dehydrogenase (Ralstonia solanacearum UW163)
MGQYTAPLRDMQFVLHELLDVEGHLKEMPAHAEIDADTINQVIEEAGKFCSEVIFPLNQS
GDREGCTYHGDGVVTAPTGFKDAYKQYVDGGWPALGCDPEYGGQGLPILINNAVYEMLNS
ANQAWTMYPGLSHGAYEALHAHGTDELKQRYLPKLVSGVWTGTMCLTEPHCGTDLGILRT
RAEPLADGAYAITGTKIFISAGEHDLSENIVHLVLARLPDAPPGTKGISLFVVPKFIPDA
GGNPGERNGVKCGSIEHKMGIHGNATCVINLDGAKGWMVGEPNKGLNAMFVMMNAARLGV
GMQGLGLTEVAYQNSAAYAKERLQMRSLSGPKAPDKPADPIIVHPDVRRMLLTQRAYAEG
GRAFAYWIALQIDRELSHPDESARKEAADLVALLTPVIKAFLTDNAFTATNEGMQVFGGH
GYIAEWGMEQYVRDARINMIYEGTNTVQSLDLLGRKILGDMGARMKKFGKIVQDFVEAEG
TSEAMQEFINPLADIGDKVQKLTMEIGMKAMANPDEVGAAAVPYLRVVGHLVFAYFWARM
AKIALEKQGNGDTFYKAKLATARFYFAKLLPETAYQIRAARAGVKPLMELEAELF