Protein Info for UW163_RS02045 in Ralstonia solanacearum UW163

Annotation: ABC transporter ATP-binding protein/permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 608 transmembrane" amino acids 36 to 57 (22 residues), see Phobius details amino acids 75 to 94 (20 residues), see Phobius details amino acids 114 to 133 (20 residues), see Phobius details amino acids 154 to 177 (24 residues), see Phobius details amino acids 183 to 204 (22 residues), see Phobius details amino acids 265 to 287 (23 residues), see Phobius details amino acids 302 to 322 (21 residues), see Phobius details PF00664: ABC_membrane" amino acids 39 to 312 (274 residues), 152.5 bits, see alignment E=1.9e-48 PF00005: ABC_tran" amino acids 378 to 526 (149 residues), 114.9 bits, see alignment E=4.6e-37

Best Hits

Swiss-Prot: 47% identical to ABCB5_DICDI: ABC transporter B family member 5 (abcB5) from Dictyostelium discoideum

KEGG orthology group: K06147, ATP-binding cassette, subfamily B, bacterial (inferred from 98% identity to rsc:RCFBP_21006)

Predicted SEED Role

"Lipid A export ATP-binding/permease protein MsbA" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (608 amino acids)

>UW163_RS02045 ABC transporter ATP-binding protein/permease (Ralstonia solanacearum UW163)
MRRYAAPSESPSAGAPARGDWQTIRGLLPYLWAYKWRVALALSFLISAKVANLGVPIVMK
RLIDTMNVSPTDPRALLVVPVGIILGYGLLRLSTSLFSELREILFAKVTESSVRTLALQV
FRHLHALSLRFHLERQTGGMSRDIERGTRGIQSLISYSLYSILPTLVEVGMVITYFMVKY
DVWFALIAFCALVSYIVFTVTVTNWRTHFRRRMNELDSRANQKAIDSLLNFETVKYFGNE
EYEARRYDENLQKYRAAAIRSQHSLSLLNFGQQFIVAVALILILYRATQGVVAGHMTLGD
LVLVNTLMLQIYIPLNFLGVIYRELKQAVTDMDRMFRLLYTNREVADKPDAQPLAVRAGE
VRVAHVDFGYEANRQILFDVDFTIPAGTTTAVVGQSGSGKSTLARLLFRFYDVTSGAILI
DGQDVRDITQTSVRAAIGIVPQDTVLFNDSIYYNIAYGRPDASRDEVIEAARAAQIHSFV
ESLPEGYDTQVGERGLKLSGGEKQRVAIARTLLKRPPILVFDEATSALDSRTEHAIQEEL
MRLAQNHTTLVIAHRLSTIVGAHQILVMEHGRIIERGTHESLLRAEGRYAQMWRMQAREP
ERVQEAAA