Protein Info for UW163_RS01745 in Ralstonia solanacearum UW163

Annotation: OmpW family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 302 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details PF03922: OmpW" amino acids 90 to 302 (213 residues), 78.8 bits, see alignment E=2.7e-26

Best Hits

KEGG orthology group: K07275, outer membrane protein (inferred from 92% identity to rsl:RPSI07_2828)

Predicted SEED Role

"Outer membrane protein assembly factor YaeT precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (302 amino acids)

>UW163_RS01745 OmpW family protein (Ralstonia solanacearum UW163)
MIRNTRRFAAAFACAASCALAAPLAHAQATAETAASINGSGGSGGGLSSFMDDYVWGRNI
MAVGWFHIRPLDSATPLTTSTSSLGLGTWQSPGTDVRVSNADTLSLTFTHFFDDNWAGTF
VGGVPPKFNLYGTGNVIAPIPVIGPLTLINLGLPQNNPVATVREWSPAIQVEYHFGTAQS
KVRPFVGVGVSYNFFTNLRLNSNFVNALQNLGQTLQLGMGQIPTGPGKVSAETSSSWTPT
ATVGVSYEFAKNWIATGSVSYLPLKTTSTITIRSQQGQVLATNKTDIKVDPIVFGLNLGY
RF