Protein Info for UW163_RS00580 in Ralstonia solanacearum UW163

Annotation: iron export ABC transporter permease subunit FetB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 272 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 41 to 61 (21 residues), see Phobius details amino acids 67 to 86 (20 residues), see Phobius details amino acids 100 to 122 (23 residues), see Phobius details amino acids 130 to 150 (21 residues), see Phobius details amino acids 193 to 215 (23 residues), see Phobius details amino acids 227 to 249 (23 residues), see Phobius details PF03649: UPF0014" amino acids 13 to 253 (241 residues), 286.5 bits, see alignment E=7.7e-90 TIGR00245: TIGR00245 family protein" amino acids 15 to 259 (245 residues), 202.8 bits, see alignment E=3.1e-64

Best Hits

KEGG orthology group: K02069, putative ABC transport system permease protein (inferred from 98% identity to rsc:RCFBP_20668)

Predicted SEED Role

"YbbM seven transmembrane helix protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (272 amino acids)

>UW163_RS00580 iron export ABC transporter permease subunit FetB (Ralstonia solanacearum UW163)
MNAPAPEQMLSAWQVGIAALLILVNGALSIGLGLGLERRLAWAAVRTVAQLLLIGFVLQW
VFASAHWTMVLAVIAAMTLIAGHATGSRGARGYAGLRWDGTLSVFASTWLIGAVGLVVVL
QARPWYTPQYAIPIMGMILGNTLTGVGLALERMTGELIATRDQVETLLALGGTRWEAARG
AARTAVRAGMTPIINQMSVVGVVSLPGMMTGQVLAGQSPLEAVRYQIVIMFLLAASSGLG
TVAAVLLAYRRLFSHEHQLLSARIVQRAPGAH