Protein Info for UW163_RS00545 in Ralstonia solanacearum UW163

Annotation: NCS2 family permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 460 transmembrane" amino acids 40 to 60 (21 residues), see Phobius details amino acids 68 to 88 (21 residues), see Phobius details amino acids 94 to 113 (20 residues), see Phobius details amino acids 119 to 140 (22 residues), see Phobius details amino acids 150 to 169 (20 residues), see Phobius details amino acids 187 to 208 (22 residues), see Phobius details amino acids 215 to 235 (21 residues), see Phobius details amino acids 237 to 241 (5 residues), see Phobius details amino acids 263 to 284 (22 residues), see Phobius details amino acids 310 to 332 (23 residues), see Phobius details amino acids 344 to 365 (22 residues), see Phobius details amino acids 371 to 393 (23 residues), see Phobius details amino acids 399 to 428 (30 residues), see Phobius details amino acids 439 to 459 (21 residues), see Phobius details PF00860: Xan_ur_permease" amino acids 38 to 420 (383 residues), 238.2 bits, see alignment E=6.8e-75

Best Hits

Swiss-Prot: 75% identical to GHXQ_ECOLI: Guanine/hypoxanthine permease GhxQ (ghxQ) from Escherichia coli (strain K12)

KEGG orthology group: K06901, putative MFS transporter, AGZA family, xanthine/uracil permease (inferred from 95% identity to rsl:RPSI07_2585)

MetaCyc: 75% identical to guanine/hypoxanthine transporter GhxQ (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-562; TRANS-RXN0-578

Predicted SEED Role

"Xanthine/uracil permease family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (460 amino acids)

>UW163_RS00545 NCS2 family permease (Ralstonia solanacearum UW163)
MAEQSLPSVTELDPAGFADTRAVDRYFQITARGSTHRREVVAGITTFMAMVYAVFVVPGM
LGKAGFDTSAVFVAVCLTTAFGSLLMGLWARLPIAIGCAISLTAFMAFGLVLGQQLAPSV
ALGAVFLMGVVFTAISVTGVRSWILRNLPAGVAHGAGIGIGLFLLLIASNEVGLVMKNPG
PGLPVSLGHITAFPVVMSVLGLATIFGLERRRVPGGILLVIIAVSMLGLIFDPAVKFTGV
FALPSLSAPGHASLIGAMDIRGALTAAVLPSVLALVMTAVFDATGTIRAVAGQAGLLDGK
GHIRNGGRALTADSVSSMVSAFFGSAPAAAYIESTVGVAAGGKTGLTAVVVGVLFLAVTF
VSPLAGLVPSYATAPALMYVGLLMLSSVSKLHMDDMVDALAGLVCAVFIVLTCNIVTGIM
LGFCTLVVGRIVAGEWRKLNAGTVAIAVALAAFYAGGWAI