Protein Info for UW163_RS00455 in Ralstonia solanacearum UW163

Annotation: hemerythrin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 137 TIGR02481: hemerythrin-like metal-binding domain" amino acids 5 to 124 (120 residues), 73.8 bits, see alignment E=6.6e-25 PF01814: Hemerythrin" amino acids 16 to 123 (108 residues), 54.3 bits, see alignment E=1e-18

Best Hits

Swiss-Prot: 90% identical to HEMTB_RALSO: Bacteriohemerythrin (RSc0777) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: None (inferred from 96% identity to rsc:RCFBP_20642)

Predicted SEED Role

"Hemerythrin"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (137 amino acids)

>UW163_RS00455 hemerythrin (Ralstonia solanacearum UW163)
MPVIQWSEALHLGDAATDANHAAFCTLLNAVADAPDADFLPALDAFITHTEAHFAEENAW
MEASEFPPLHCHRNEHDNVLALCREVRRRAADGDMTLGRRLVAELPAWFADHVDVMDRMM
TTWLAQRGPDARAEAAA