Protein Info for UW163_RS00285 in Ralstonia solanacearum UW163

Annotation: oxidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00174: Oxidored_molyb
  • amino acids 100 to 272 (173 residues), 173.5 bits, E=3.1e-55
• PF03404: Mo-co_dimer
  • amino acids 299 to 407 (109 residues), 35.3 bits, E=1.1e-12

Best Hits

KEGG orthology group: K07147, (no description) (inferred from 97% identity to rsc:RCFBP_20603)

MetaCyc: 64% identical to sulfite:cytochrome c oxidoreductase molybdenum subunit (Starkeya novella)
Sulfite dehydrogenase. [EC: 1.8.2.1]

Predicted SEED Role

"Twin-arginine translocation pathway signal"

MetaCyc Pathways

• superpathway of sulfide oxidation (Starkeya novella) (4/5 steps found)
• sulfite oxidation I (1/1 steps found)
• superpathway of sulfide oxidation (Acidithiobacillus ferrooxidans) (7/10 steps found)
• superpathway of sulfur metabolism (Desulfocapsa sulfoexigens) (2/6 steps found)
• superpathway of sulfur oxidation (Acidianus ambivalens) (1/9 steps found)

KEGG Metabolic Maps

• Sulfur metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.2.1

Protein Sequence (416 amino acids)

>UW163_RS00285 oxidase (Ralstonia solanacearum UW163)
MHPLDPPRRTTRRSVLKALGTLGAGATLGHPALTALAATAGRVTLPFDNGERELVVFPQK
RPLILQTSRPPQLETPFAVFNEGVITPNDAFFVRYHWSGIPTSIDPATYRLQVSGNVDTP
LDLSLGELKALGEAREIVAINQCSGNGRGHFQPRIGGGQLSNGAMGNARWTGVPLRQVLD
KAGVRAGSVQVVFDGLDHPPLADAKSPDFIKALDIDHARDGEVMIAWAMNGADLPMLNGY
PIRLIVPGYYGTYWIKHLSEIRVVDKPFDGFWMRTAYRIPDNACACVAPGTTPARTVPIG
RLNVRSFITSLADGASVAAGREHIVRGIAFDGGYGVTEVAFSADGGRTWSAARLGEDLGN
YSFREWHAPFRPARRGAYELKVRAVNRIGQSQPLTALWNPAGYMRNVVETTRVTAA