Protein Info for RPSI07_RS23965 in Ralstonia solanacearum PSI07

Annotation: ribonuclease P protein component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00825: Ribonuclease_P
  • amino acids 6 to 98 (93 residues), 85 bits, E=1.8e-28
• TIGR00188: ribonuclease P protein component
  • amino acids 10 to 90 (81 residues), 58 bits, E=5.1e-20

Best Hits

Swiss-Prot: 78% identical to RNPA_RALPJ: Ribonuclease P protein component (rnpA) from Ralstonia pickettii (strain 12J)

KEGG orthology group: K03536, ribonuclease P protein component [EC: 3.1.26.5] (inferred from 97% identity to rso:RSc0002)

Predicted SEED Role

"Ribonuclease P protein component (EC 3.1.26.5)" in subsystem tRNA processing (EC 3.1.26.5)

MetaCyc Pathways

• tRNA processing (8/10 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.26.5

Protein Sequence (144 amino acids)

>RPSI07_RS23965 ribonuclease P protein component (Ralstonia solanacearum PSI07)
MGPHAFPKAARLVKTDEFSSVFALRPVRRSRHFVLYVRANGHPQARLGIVVGKKFARRAV
ERNLIKRQCRELFRLRQAALGGRDVLIRLQTKFPREDVPTVAAFKRLCREELSYLFEIAA
RPLPAPPPVPSPAAAPVPSDGAAP