Protein Info for RPSI07_RS23955 in Ralstonia solanacearum PSI07

Annotation: membrane protein insertase YidC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 554 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details transmembrane" amino acids 364 to 384 (21 residues), see Phobius details amino acids 428 to 451 (24 residues), see Phobius details amino acids 474 to 491 (18 residues), see Phobius details amino acids 504 to 527 (24 residues), see Phobius details TIGR03593: membrane protein insertase, YidC/Oxa1 family, N-terminal domain" amino acids 4 to 362 (359 residues), 368.4 bits, see alignment E=5.8e-114 PF14849: YidC_periplas" amino acids 85 to 353 (269 residues), 282 bits, see alignment E=8.2e-88 TIGR03592: membrane protein insertase, YidC/Oxa1 family" amino acids 363 to 542 (180 residues), 249.6 bits, see alignment E=2.4e-78 PF02096: 60KD_IMP" amino acids 364 to 542 (179 residues), 229.2 bits, see alignment E=2.8e-72

Best Hits

Swiss-Prot: 94% identical to YIDC_RALSO: Membrane protein insertase YidC (yidC) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K03217, preprotein translocase subunit YidC (inferred from 100% identity to rsl:RPSI07_3382)

Predicted SEED Role

"Inner membrane protein translocase component YidC, long form"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (554 amino acids)

>RPSI07_RS23955 membrane protein insertase YidC (Ralstonia solanacearum PSI07)
MDIKRTILWVIFSLSVVLLFDNWQRANGHQSMFFPTPQTATTSAAAPGGTPAGDVPKSAA
APAAAGSQAAPATGAASQTPAAEKIVVTTDVIRATVDTAGAILTKLELLTQKDHDGNPVV
LFDRSLERTYLARSGLIGGDFPNHTTVFTASAGPRDLGTGGEVSLTLTADKGGAKLAKTY
VFKRGSYVIDTRFDVTNDGTAPISPTLYMELARDGGSVEQSRFYSTFTGPAVYTDADKFH
KINFSDIDKGKAHVPAATDNGWVGMVQHYFASAWIPAASAKREFYVDRVDTNFYRIGIQE
PLGTVAPGANISATARLFAGPQEERMLEGITPGLELVKDYGWLTIIAKPLFWLLEKIHLL
LGNWGWSIVGLTVLVKLVFFPLSATSYRSMAKMKDLQPRMTAIRERHKGDPQKMNQEMMQ
LYRTEKVNPLGGCLPIVIQIPVFIALYWVLLSSVEMRGAPWLGWVHDLASPDPFYILPIL
MAVSMFVQTRLNPTPPDPVQAKMMMFMPIAFSVMFFFFPAGLVLYWVVNNCLSIAQQWSI
NRMLGTSKKAAPTK