Protein Info for RPSI07_RS23720 in Ralstonia solanacearum PSI07

Annotation: RNA polymerase-binding protein DksA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 139 TIGR02420: RNA polymerase-binding protein DksA" amino acids 21 to 129 (109 residues), 147 bits, see alignment E=1.3e-47 PF21157: DksA_CC" amino acids 25 to 94 (70 residues), 92.7 bits, see alignment E=1.3e-30 PF01258: zf-dskA_traR" amino acids 97 to 132 (36 residues), 47.2 bits, see alignment E=1.8e-16

Best Hits

Swiss-Prot: 50% identical to DKSA_CAUVN: RNA polymerase-binding transcription factor DksA (dksA) from Caulobacter vibrioides (strain NA1000 / CB15N)

KEGG orthology group: K06204, DnaK suppressor protein (inferred from 93% identity to rso:RSc0046)

Predicted SEED Role

"C4-type zinc finger protein, DksA/TraR family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (139 amino acids)

>RPSI07_RS23720 RNA polymerase-binding protein DksA (Ralstonia solanacearum PSI07)
MSSKKLLTEAEILKMGDKDYMNEAQLAFFKDRLEKLRDEILKNADQTTEHLRETVIVPDP
ADRATIEEEHALELRTRDRERKLLKKVEQSIARIEAGDYGWCEETGEPIGVPRLLARPTA
TLSLEAQERREKRQKLYGD