Protein Info for RPSI07_RS23595 in Ralstonia solanacearum PSI07

Annotation: glycosyltransferase family 39 protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 657 transmembrane" amino acids 23 to 43 (21 residues), see Phobius details amino acids 102 to 124 (23 residues), see Phobius details amino acids 165 to 183 (19 residues), see Phobius details amino acids 230 to 256 (27 residues), see Phobius details amino acids 268 to 288 (21 residues), see Phobius details amino acids 327 to 347 (21 residues), see Phobius details amino acids 362 to 386 (25 residues), see Phobius details amino acids 392 to 411 (20 residues), see Phobius details amino acids 420 to 447 (28 residues), see Phobius details amino acids 468 to 490 (23 residues), see Phobius details amino acids 497 to 519 (23 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 100% identity to rsl:RPSI07_3305)

Predicted SEED Role

"FIG00975731: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (657 amino acids)

>RPSI07_RS23595 glycosyltransferase family 39 protein (Ralstonia solanacearum PSI07)
MTSSESDGDAASRRLPLLLVRHWRWAIMLMVAAYLIAGTFWRAPWKADEPYSFGIVLNII
ERGDWIVPNVAFEPFVEKPPLMYWSGALAALAVPELPPHEAVRLAVLFWMGLACLAVWRT
ARLLRSEARDWRMRIGAQLARGPAPTLAERRVAGLDAGSTVLRDYALGALLLFVGCIGLV
EHVHKFIADVPQLAGTALALYGLVRYAKACETGGTDGVEVMRPALWFGTGLGVAFLGKGV
LVPGLFALTVVAAMALLPDFRSRQAWRFYLVSLLAASPWLLIWPVIFWRESPDLFIEWFW
VNNIGRFFGFTHLGGEKSSLDATVRSIFLTGTPAVWPALGVLGVSLWKLARQRGRGARAA
WLLPYQGHLVVALFVLATLTVVLRSAVLRDVYLMPLQPALALLGAPMLMLMPPAWRARIW
GVLVVLFAAMALVVWGVWAALVTSSGAWLPGWLAKSLGRVLPLPYDMLVHPVAVLAAVGM
TALWAVCMWLRPARSGVVAWAAGIGLVWGLLGTLLMPWIDDARSYRPLFQAIKPVLESAQ
ICVATRGMGESERALMHYETGVRPVKWLLGHSGTGDEHRPNPAARTCDLMLVLEKRPEHS
RRRPRGDDWELVWRGSRPGDTNETFSLFQRRSTGVAEALPAPEPIVPLTDTPQRGRQ