Protein Info for RPSI07_RS23580 in Ralstonia solanacearum PSI07

Annotation: zinc metalloprotease HtpX

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 286 transmembrane" amino acids 7 to 25 (19 residues), see Phobius details amino acids 31 to 48 (18 residues), see Phobius details amino acids 141 to 164 (24 residues), see Phobius details amino acids 177 to 197 (21 residues), see Phobius details PF01435: Peptidase_M48" amino acids 67 to 278 (212 residues), 119.1 bits, see alignment E=1.1e-38

Best Hits

Swiss-Prot: 97% identical to HTPX_RALSO: Protease HtpX homolog (htpX) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K03799, heat shock protein HtpX [EC: 3.4.24.-] (inferred from 100% identity to rsl:RPSI07_3302)

Predicted SEED Role

"Peptidase M48, Ste24p precursor"

Isozymes

Compare fitness of predicted isozymes for: 3.4.24.-

Use Curated BLAST to search for 3.4.24.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (286 amino acids)

>RPSI07_RS23580 zinc metalloprotease HtpX (Ralstonia solanacearum PSI07)
MFNWIKTFMLMAAITALFIVIGGMIGGRNGMMLALLFALGMNVFSYWFSDRMVLRMYNAQ
EVNETTAPQFYRMVQELSGRAGLPMPRVYLIDEAQPNAFATGRNPEHAAVAATTGILNIL
SERELRGVMAHELAHVQHRDILISTISATMAGAISALANFAVFFGGRDEEGRPVNPIAGI
AVAILAPLAASLIQMAISRAREFEADRGGALISGDPQALASALDKIHRYAAGIPFAAAEA
HPATAQMMIMNPLHGGGLANLFSTHPATEERIARLMHMAQTGTYPA