Protein Info for RPSI07_RS23565 in Ralstonia solanacearum PSI07

Annotation: PAS domain-containing sensor histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 811 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 50 to 71 (22 residues), see Phobius details amino acids 83 to 105 (23 residues), see Phobius details amino acids 344 to 368 (25 residues), see Phobius details PF00672: HAMP" amino acids 367 to 417 (51 residues), 40.9 bits, see alignment 4.1e-14 PF08448: PAS_4" amino acids 441 to 560 (120 residues), 26.1 bits, see alignment E=1.7e-09 PF00512: HisKA" amino acids 571 to 637 (67 residues), 38.8 bits, see alignment E=1.5e-13 PF02518: HATPase_c" amino acids 685 to 796 (112 residues), 65.1 bits, see alignment E=1.5e-21

Best Hits

KEGG orthology group: None (inferred from 100% identity to rsl:RPSI07_3299)

Predicted SEED Role

"Nitrogen regulation protein NtrY (EC 2.7.3.-)" (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.3.-

Use Curated BLAST to search for 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (811 amino acids)

>RPSI07_RS23565 PAS domain-containing sensor histidine kinase (Ralstonia solanacearum PSI07)
MIFDRSYKRLLYQVVAGTIVFLAIVLVGLLAAASANTEFFDRYFTLLYKVNLVIGVLLVV
IIGGLMLALALRARRGKFGTRLMTKLAVFFGVVGVLPGVLIYLVSLQFVSRSIESWFDVK
VESALEAGLNLGRTTMDASLVELQNKGRLIAEQLGDGSASATAITLNRLREQFGVQEATI
FAGSGRVVATSSSAYDTLVPEFPSQAVLEQARAPGGYASLEGGSDSTADGEAASAPAARA
GNRRSDLYQLRVVLALGTTTRDDAALAPHTPVRKWAGSGLLADRRPDDSSTRGFGLIGEA
GREERFLQLVQPVPQALARNADAVQRAYQEYQEKALGRTGLRKMYIGTLTLTLFLAVFIA
VMLALLLGAQLARPLLMLLQGTREVAEGDLSPKRELHTRDELGLLTQQFNQMTRQLADAR
RAVEQNRAALEQSKAYLESVLTNLTAGVFVFDYRFVLLTANPGAERIFKQPFGAWVGQSL
SSITPLQAFAGTLEHAFAEHDVSAAAGGAAAHWQKQVEIPLADEEEPLTLLARGTRLPGP
SVGARGTERGYVVVFDDISDVISAQRSVAWGEVARRLAHEIKNPLTPIQLSAERLEMKLS
PKLTDADAEVLRRGATTIVNQVAAMKRMVDDFRDYARTPPAVLQALDLNALCAEVLHLYG
IDHPGQHDHPVIEVRLGQDLPLINGDPTQLRQVIHNLLQNAQDAVADNEAAGRPAAHVML
QTDTVEYDDASGARRQAVRLSIADNGTGFSSRILNRAFEPYVTTKAKGTGLGLAMVKKIM
DEHGARIELRNRQSGTDTVGAQVSILFVKLA