Protein Info for RPSI07_RS23340 in Ralstonia solanacearum PSI07

Annotation: HPP family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 378 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 29 to 46 (18 residues), see Phobius details amino acids 53 to 72 (20 residues), see Phobius details amino acids 78 to 96 (19 residues), see Phobius details amino acids 103 to 121 (19 residues), see Phobius details amino acids 128 to 147 (20 residues), see Phobius details amino acids 153 to 171 (19 residues), see Phobius details PF04982: HPP" amino acids 56 to 176 (121 residues), 132.1 bits, see alignment E=1.3e-42 PF00571: CBS" amino acids 238 to 288 (51 residues), 57.4 bits, see alignment 1.5e-19 amino acids 313 to 368 (56 residues), 50.9 bits, see alignment 1.6e-17

Best Hits

KEGG orthology group: K07168, CBS domain-containing membrane protein (inferred from 100% identity to rsl:RPSI07_3251)

Predicted SEED Role

"Probable transmembrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (378 amino acids)

>RPSI07_RS23340 HPP family protein (Ralstonia solanacearum PSI07)
MYRLALLRWLASFAPAPVTVRWTERLRSAAGALVGILLTGAAMHCVPDGPVPVPLLVAPM
GASAVLLFAVPASPLAQPWSIIGGNLVASVVGVTCARMIGDPVLASALAVSLAIGGMFAL
RCVHPPSGAVALTAVIGGPAVHALGYRFVLEPVAVQSALLLVAAIAYHAATGHRYPHAHR
RTATEHAPPPGGLTRADVLAALRRQGEWLDIDPEDLTALLREMQQQAYARTFHALTCADI
MTPSVVTVSAATSVPHALRLLQRHGVKALPVLDDEHRLIGIVTRADLTGTAARARRQRLR
DWFAIGAMTPPRVGGVMTPRVLTIRADAPMADLVPMFASAGHHHIPVVDAHGRLAGILTQ
ADIIHALYRQASVQRPAA