Protein Info for RPSI07_RS23015 in Ralstonia solanacearum PSI07

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 398 transmembrane" amino acids 22 to 42 (21 residues), see Phobius details amino acids 48 to 48 (1 residues), see Phobius details amino acids 50 to 71 (22 residues), see Phobius details amino acids 80 to 101 (22 residues), see Phobius details amino acids 108 to 128 (21 residues), see Phobius details amino acids 140 to 160 (21 residues), see Phobius details amino acids 166 to 187 (22 residues), see Phobius details amino acids 208 to 229 (22 residues), see Phobius details amino acids 235 to 255 (21 residues), see Phobius details amino acids 275 to 297 (23 residues), see Phobius details amino acids 312 to 331 (20 residues), see Phobius details amino acids 344 to 371 (28 residues), see Phobius details PF06772: LtrA" amino acids 18 to 377 (360 residues), 373.6 bits, see alignment E=5.8e-116

Best Hits

KEGG orthology group: None (inferred from 100% identity to rsl:RPSI07_3181)

Predicted SEED Role

"Bll5714 protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (398 amino acids)

>RPSI07_RS23015 membrane protein (Ralstonia solanacearum PSI07)
MPRSYLRPAPSGAHGHHRVTNIELFFDLVFVFAVTQLSHLLIGNFTLIGGAQTLLLMLAV
WWVWIFTSWVTNWLDPEQFAIRLLLLVLMTAGLLLSASLPQAFGSRGLAFALAYVFMQFG
RTLFSLWAMRGESLGMRRNFQRIAVWLGVSAVFWLAGGLADGPARWAGWIVALGIEWLGP
SAGFYTPGLGRSTVDDWNVEGGHMAERCSLFIIIALGESVLVTGSTFAGLDWSPANIAAM
AMSFIGSLAMWWLYFDTIAERGSQTISHAADPGRLARLAYTYIHVLLVAGIIVGAVADEF
VLAHPVGHPHPGAALAVLGSAALYLLGNLLFKCAIFGRARRAHVLGLVALGLAGLVAAAL
PALAVSALATLVLCGTAAWEWYTRSCEVPAAAGHERRA