Protein Info for RPSI07_RS22720 in Ralstonia solanacearum PSI07

Annotation: DNA-binding response regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 210 PF00072: Response_reg" amino acids 4 to 116 (113 residues), 107.7 bits, see alignment E=3.6e-35 PF00196: GerE" amino acids 147 to 203 (57 residues), 58 bits, see alignment E=5.7e-20

Best Hits

Swiss-Prot: 35% identical to NREC_STACT: Oxygen regulatory protein NreC (nreC) from Staphylococcus carnosus (strain TM300)

KEGG orthology group: None (inferred from 98% identity to rpf:Rpic12D_0153)

Predicted SEED Role

"DNA-binding response regulator, LuxR family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (210 amino acids)

>RPSI07_RS22720 DNA-binding response regulator (Ralstonia solanacearum PSI07)
MIRVLIADDHEIVRAGLRQFLSEERDIEVAGEAASGEEVMEQLRTGVFDVVVLDISMPDR
NGIDTLKLVRQRHPDLPVLILSTFPEDQYAINLIRAGASGYLTKESAPDELVKAIRTVSQ
GRRYVSPTVAELLIGGLEKPTDQPLHQTLSKREFQIFCKLARGQSVSIIAEELFLSVKTV
STYRTRILEKMGMKSNADLTYYAIKNGLVE