Protein Info for RPSI07_RS22610 in Ralstonia solanacearum PSI07

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 374 transmembrane" amino acids 114 to 139 (26 residues), see Phobius details amino acids 166 to 186 (21 residues), see Phobius details amino acids 193 to 209 (17 residues), see Phobius details amino acids 215 to 236 (22 residues), see Phobius details amino acids 257 to 286 (30 residues), see Phobius details amino acids 311 to 334 (24 residues), see Phobius details amino acids 347 to 369 (23 residues), see Phobius details TIGR00056: ABC transport permease subunit" amino acids 133 to 370 (238 residues), 214.6 bits, see alignment E=9.6e-68 PF02405: MlaE" amino acids 159 to 367 (209 residues), 227.1 bits, see alignment E=9.5e-72

Best Hits

KEGG orthology group: K02066, putative ABC transport system permease protein (inferred from 100% identity to rsl:RPSI07_3097)

Predicted SEED Role

"ABC-type transport system involved in resistance to organic solvents, permease component USSDB6A"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (374 amino acids)

>RPSI07_RS22610 ABC transporter permease (Ralstonia solanacearum PSI07)
MITCRPPQLEVRVVDGRSVAYLSGDWTTLALAERAGVRSARRQIRAGLNNANAWCLTEVG
RIDHFGAQLLWRAWGNRWPERLDARPDQRRMIDRVARLDPGGWKKRIAPRINPVMVLGGA
MFDFAGHLQIGVAMVGQLMFDLLRFVRAPHRGPWREISANIYSTGYKALGITALVGFLIG
IVLSYLSANQLRVFGASIFIVNILGMAIIRELGPVLAAILVAGRSGSAITAQIGVMRVTE
ELDAMRVMGISHGFRLILPKVIALAIAMPLLVAWTDLLALAGGILAAKFQLDISPTYFIT
SLPDAVPVANLWLGIGKGVVFGMLIALVACHFGLRIQPNTQSLGEGTTTSVVVSITIVIL
ADAVFAILFKDVGI