Protein Info for RPSI07_RS22590 in Ralstonia solanacearum PSI07

Annotation: teicoplanin resistance protein VanZ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 397 transmembrane" amino acids 22 to 42 (21 residues), see Phobius details amino acids 63 to 83 (21 residues), see Phobius details amino acids 93 to 113 (21 residues), see Phobius details amino acids 126 to 147 (22 residues), see Phobius details amino acids 159 to 180 (22 residues), see Phobius details amino acids 236 to 255 (20 residues), see Phobius details amino acids 263 to 285 (23 residues), see Phobius details amino acids 296 to 315 (20 residues), see Phobius details amino acids 322 to 342 (21 residues), see Phobius details amino acids 365 to 383 (19 residues), see Phobius details PF04892: VanZ" amino acids 36 to 139 (104 residues), 38.4 bits, see alignment E=8.9e-14

Best Hits

KEGG orthology group: None (inferred from 100% identity to rsl:RPSI07_3093)

Predicted SEED Role

"Probable transmembrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (397 amino acids)

>RPSI07_RS22590 teicoplanin resistance protein VanZ (Ralstonia solanacearum PSI07)
MTDLHALPAAPSTHRHSPLARAGLAWFVLLVVYASLYPFSGWVDTGVPPFAYLTAPLPRY
NTLFDLLTNIWGYMPLGMLVVLSLHPRITGWRAVALAMLAGLLLSGAMEAAQTYLPTRIS
SNVDLAANTVGALLGGIVMAPFAVRLIDRGSLRRLRWRWFEPQATFAIPLLLLWPFAQIF
PQEFLFSMGGVVRSILLDPSPDAFLTGIIHSLFPGLFDWHDRLQAHPEALRRQELLEALI
TACSWVGTGLLATVAMRRTAPVLRLLAALLASALLVKAGATLLQFPAAGAWDWLSSGGRF
GLVVGSLVLVLLVRLPRGLRGALAMLLLLALIVLSNVLPPGPYSWVSAQGWRLGRFVHFN
SLSQWIGWVWPFLGVGYLAWRAELAQLQRRARRRGAA