Protein Info for RPSI07_RS22350 in Ralstonia solanacearum PSI07
Annotation: cytochrome c oxidase assembly protein
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 36% identical to COXZ_RHOP5: Cytochrome c oxidase assembly protein CtaG (ctaG) from Rhodopseudomonas palustris (strain BisA53)
KEGG orthology group: K02258, cytochrome c oxidase subunit XI assembly protein (inferred from 100% identity to rsl:RPSI07_3044)Predicted SEED Role
"Cytochrome oxidase biogenesis protein Cox11-CtaG, copper delivery to Cox1" in subsystem Biogenesis of cytochrome c oxidases
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (202 amino acids)
>RPSI07_RS22350 cytochrome c oxidase assembly protein (Ralstonia solanacearum PSI07) MDETPARPDPTDDAKVAERGLNRAMLGKLAVVVVMMFGFGYAMVPLYKKICEVTNINVLT TRDLDGGALRNTQVDQARTVTVEFDSNSQGPFRFRPVKNSMEVHPGEINQIVYEVVNKEG RSVSAQAIPSYAPKQATEFFKKIECFCFKQQTLAGNESREMPVVFVIDPNLPKDVKTITL SYTFFEIGKPAAQTPTVPGKGT