Protein Info for RPSI07_RS22255 in Ralstonia solanacearum PSI07

Annotation: maleylacetoacetate isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 216 PF02798: GST_N" amino acids 1 to 75 (75 residues), 63.6 bits, see alignment E=3.4e-21 TIGR01262: maleylacetoacetate isomerase" amino acids 4 to 213 (210 residues), 280 bits, see alignment E=5.7e-88 PF13417: GST_N_3" amino acids 5 to 81 (77 residues), 58.8 bits, see alignment E=1.1e-19 PF13409: GST_N_2" amino acids 11 to 77 (67 residues), 58.8 bits, see alignment E=1.3e-19 PF00043: GST_C" amino acids 140 to 200 (61 residues), 30.9 bits, see alignment E=5.3e-11

Best Hits

Swiss-Prot: 52% identical to MAAI_VIBCH: Probable maleylacetoacetate isomerase (maiA) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K01800, maleylacetoacetate isomerase [EC: 5.2.1.2] (inferred from 100% identity to rsl:RPSI07_3023)

MetaCyc: 51% identical to glutathion-dependent maleylpyruvate isomerase (Ralstonia sp. U2)
Maleylpyruvate isomerase. [EC: 5.2.1.4]

Predicted SEED Role

"Maleylacetoacetate isomerase (EC 5.2.1.2) @ Glutathione S-transferase, zeta (EC 2.5.1.18)" (EC 2.5.1.18, EC 5.2.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.18, 5.2.1.2

Use Curated BLAST to search for 2.5.1.18 or 5.2.1.2 or 5.2.1.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (216 amino acids)

>RPSI07_RS22255 maleylacetoacetate isomerase (Ralstonia solanacearum PSI07)
MSIKLYNYFRSSASFRVRIALEVKGLPYDYAPVHLLKGEQSAPDFVKLNPDALVPVLCDG
TEVLNQSLAIVEYLEETHPEPTLLPGSAADRAHIRAIALAIACEIHPLNNPRVLKYLKHT
FSVDDDARNDWYRYWVRLGFAALETRLSQSPRTGAYCVGDTPTLADLCLVPQVFNGKRFD
VAVEDYPTLARIFAHCMAQPAFQRAAPAAQPDAASA