Protein Info for RPSI07_RS22230 in Ralstonia solanacearum PSI07

Annotation: 16S rRNA (guanine(966)-N(2))-methyltransferase RsmD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 215 TIGR00095: 16S rRNA (guanine(966)-N(2))-methyltransferase RsmD" amino acids 20 to 170 (151 residues), 122.1 bits, see alignment E=1.1e-39 PF03602: Cons_hypoth95" amino acids 24 to 171 (148 residues), 144.1 bits, see alignment E=7.8e-46 PF05175: MTS" amino acids 55 to 148 (94 residues), 30 bits, see alignment E=7.7e-11 PF13847: Methyltransf_31" amino acids 67 to 171 (105 residues), 28.7 bits, see alignment E=2.1e-10 PF13578: Methyltransf_24" amino acids 80 to 166 (87 residues), 33.5 bits, see alignment E=1.3e-11

Best Hits

KEGG orthology group: None (inferred from 100% identity to rsl:RPSI07_3018)

Predicted SEED Role

"Ribosomal RNA small subunit methyltransferase D (EC 2.1.1.-)" (EC 2.1.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (215 amino acids)

>RPSI07_RS22230 16S rRNA (guanine(966)-N(2))-methyltransferase RsmD (Ralstonia solanacearum PSI07)
MASRTPNRPKTPSATSHARAPHQVRIIGGQYKRTPLPVIDAEGLRPTGDRVRETLFNWLG
QDLAGWRCADIFAGTGALGFEAASRGAEQVTLVENHAPALRALHAVRDKLRAGMVDIVQG
DAFAWLARQADGAFDLVFIDPPFAQDWALRALEAALRVVPEGGLIYVELPRPLVAAVPGE
GVAPEVGIPLPAGVVLHRHLRAGAVHAHLLLRKNG