Protein Info for RPSI07_RS21585 in Ralstonia solanacearum PSI07

Annotation: anhydro-N-acetylmuramic acid kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 386 PF03702: AnmK" amino acids 14 to 386 (373 residues), 455.2 bits, see alignment E=8.7e-141

Best Hits

Swiss-Prot: 95% identical to ANMK_RALSO: Anhydro-N-acetylmuramic acid kinase (anmK) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K09001, anhydro-N-acetylmuramic acid kinase [EC: 2.7.1.-] (inferred from 100% identity to rsl:RPSI07_2872)

Predicted SEED Role

"Anhydro-N-acetylmuramic acid kinase (EC 2.7.1.-)" (EC 2.7.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.-

Use Curated BLAST to search for 2.7.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (386 amino acids)

>RPSI07_RS21585 anhydro-N-acetylmuramic acid kinase (Ralstonia solanacearum PSI07)
MLTRMKTPASSASERYIGLMSGTSLDGVDGVLVDFSSPRPMLLTDAYIPFPPELRQAFFD
LQFAGHNEIHREALAANALADLYAECVAQLLHESGCDPREVRAIGAHGQTIRHQPGEHDG
IGYTRQTQHAAVLAERTGIDVIADFRSRDIAAGGQGAPLVPAVHRALFALPDAWRVVCNI
GGIANLTVLPPQQSDAHDRVLGFDCGPGNALLDYWVHTHRGEAYDRDGEWARSGWIDAAL
LETLRGEPFFARVPPKSTGRDLFNPTWLQQQAGDALERIRPEDVQATLLALTADTIADAV
RTYAPHTASLVVCGGGARNGALMQRLAAQLPGTPIAPSDDFGIPAHQVEALAFAWLARQC
VRREPGNVHHATGAAGPRVLGTIYPA