Protein Info for RPSI07_RS21500 in Ralstonia solanacearum PSI07

Annotation: bifunctional diguanylate cyclase/phosphodiesterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 701 transmembrane" amino acids 6 to 28 (23 residues), see Phobius details amino acids 41 to 65 (25 residues), see Phobius details amino acids 77 to 97 (21 residues), see Phobius details amino acids 107 to 127 (21 residues), see Phobius details amino acids 137 to 161 (25 residues), see Phobius details amino acids 173 to 195 (23 residues), see Phobius details amino acids 215 to 237 (23 residues), see Phobius details PF03707: MHYT" amino acids 52 to 110 (59 residues), 88 bits, see alignment 4.9e-29 amino acids 115 to 171 (57 residues), 63.7 bits, see alignment 1.9e-21 amino acids 182 to 245 (64 residues), 33.6 bits, see alignment E=4.9e-12 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 260 to 421 (162 residues), 135.8 bits, see alignment E=6e-44 PF00990: GGDEF" amino acids 263 to 418 (156 residues), 151.7 bits, see alignment E=2.4e-48 PF00563: EAL" amino acids 439 to 674 (236 residues), 257.4 bits, see alignment E=1.8e-80

Best Hits

Swiss-Prot: 70% identical to Y1727_PSEAE: Uncharacterized signaling protein PA1727 (PA1727) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 100% identity to rsl:RPSI07_2854)

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (701 amino acids)

>RPSI07_RS21500 bifunctional diguanylate cyclase/phosphodiesterase (Ralstonia solanacearum PSI07)
MLAGSYHPLLVLLSLFVAILASYTALDMAGRIATARGRAVHWWLAGGACAMGLGIWSMHF
VGMLAFSLPIPLGYDPWITLASLLIAMALSAFALWLVCQRRLPWPRLAGGALLMGAGVAS
VHYTGMAAMRMSPGILYDPALFCLSVVIAILASGAALWIAFRLRRQSGRVRAMRAGASVV
MGLAIVGMHYTGMAAAGFPLGSICGAARGGVSVEWLALVIIVVTLAVLAMALVISVLDLR
MEARTAVLATSLAEANQALAYLALHDNLTKLSNRLLLEDRLEQAIQSAGRNRGSFALMFL
DLDGFKAVNDVYGHHAGDLLLADVARRIVACVRQQDTVARVGGDEFVVLAGVSEPADAGT
LADTLLAAVRGPFLVDGHELRVSTSIGIALYPGDGAGQHDLLTNADAAMYHAKGMGRDTY
CFFEASMNANVHQQLQLVQDLRLALERRELVLHYQPKFSAPDGPVVGVEALVRWQHPARG
MLPPDAFIPLAEKTSLIVPLGAWVLDEACRQMAQWRREGRTGWSIAVNLSAVQFAHAALV
DTVRDTLARHALEPQGLTLEITESTAMRDADASLHILRQLHAMGVRISIDDFGTGYSSLL
YLKRLPASELKIDRGFVRDLAHDSEDAAIVSAVVALGQTLNLRIVAEGVETEAQQAFLTR
LGCHALQGNLLGRPMTAEALADAAALAEAPGAQAMRAEGRA