Protein Info for RPSI07_RS21260 in Ralstonia solanacearum PSI07

Annotation: recombinase RecA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 352 TIGR02012: protein RecA" amino acids 13 to 333 (321 residues), 572.7 bits, see alignment E=1.1e-176 PF00154: RecA" amino acids 16 to 277 (262 residues), 473.5 bits, see alignment E=4.6e-146 PF08423: Rad51" amino acids 47 to 236 (190 residues), 32.2 bits, see alignment E=1.7e-11 PF06745: ATPase" amino acids 48 to 214 (167 residues), 28.1 bits, see alignment E=3.2e-10 PF21096: RecA_C" amino acids 280 to 336 (57 residues), 98.6 bits, see alignment E=4.3e-32

Best Hits

Swiss-Prot: 98% identical to RECA_RALSO: Protein RecA (recA) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K03553, recombination protein RecA (inferred from 99% identity to rsc:RCFBP_20924)

MetaCyc: 70% identical to DNA recombination/repair protein RecA (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"RecA protein" in subsystem DNA-replication or DNA repair, bacterial or DNA repair, bacterial RecFOR pathway

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (352 amino acids)

>RPSI07_RS21260 recombinase RecA (Ralstonia solanacearum PSI07)
MEDGKKAASMSAEKQKALAAALAQIEKQFGKGSIMKMGDAEVEPVQVVSTGSLGLDVALG
VGGLPRGRVVEIYGPESSGKTTLTLQVVAEMQKLGGTCAFIDAEHALDVTYADKLGVKVP
DLLISQPDTGEQALEIADALVRSGSVDLIVIDSVAALVPKAEIEGEMGDALPGLQARLMS
QALRKLTGTIKRTNCLVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGSIK
RGDEVVGNETKVKVVKNKVAPPFREAIFDILYGAGVSREGEIIDLGVEAKVVEKSGAWYS
YNGDRIGQGRDNCREFLRENPELAREIENKVREHLGVVPMGAVVLAEEVEEE