Protein Info for RPSI07_RS20985 in Ralstonia solanacearum PSI07

Annotation: paraquat-inducible protein A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 244 transmembrane" amino acids 81 to 102 (22 residues), see Phobius details amino acids 127 to 155 (29 residues), see Phobius details amino acids 176 to 201 (26 residues), see Phobius details amino acids 208 to 225 (18 residues), see Phobius details PF04403: PqiA" amino acids 78 to 234 (157 residues), 180.7 bits, see alignment E=8.7e-58

Best Hits

KEGG orthology group: K03808, paraquat-inducible protein A (inferred from 92% identity to rsc:RCFBP_20871)

Predicted SEED Role

"Paraquat-inducible protein A" in subsystem Oxidative stress

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (244 amino acids)

>RPSI07_RS20985 paraquat-inducible protein A (Ralstonia solanacearum PSI07)
MTAANTTPTPSPQPARPLRAAAHGLATCERCGLLARLPGAREAARAALAQEEAPDPATAA
PVCPRCLSPIHVRKPDGLRRCWALLLAGAAMYLPANMLPVMITETLLGTQQDTILSGIVY
LWTSGSWHLAIIVFIASFFVPLAKLGILAMLCLSVRQRWRWKPRTRTRLYVIVEAIGRWS
MLDVFVIALLAGLVHLSTLAVIKPGPGVAPFAGVVVLTMLAARCFDPRLIWDAIDEPDSE
ETTA