Protein Info for RPSI07_RS20545 in Ralstonia solanacearum PSI07

Annotation: channel protein TolC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 484 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details TIGR01844: type I secretion outer membrane protein, TolC family" amino acids 38 to 455 (418 residues), 334.3 bits, see alignment E=5.7e-104 PF02321: OEP" amino acids 42 to 227 (186 residues), 88.3 bits, see alignment E=3e-29 amino acids 251 to 439 (189 residues), 100.3 bits, see alignment E=6.1e-33

Best Hits

KEGG orthology group: K12340, outer membrane channel protein TolC (inferred from 100% identity to rsl:RPSI07_2654)

Predicted SEED Role

"Type I secretion outer membrane protein, TolC precursor" in subsystem Multidrug Resistance Efflux Pumps or Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (484 amino acids)

>RPSI07_RS20545 channel protein TolC (Ralstonia solanacearum PSI07)
MSVARSSRARMAVRGSLVVLCWSMAPMLAWAQADAPTTDLLSAYRAALANDPQFASVRAQ
SLAQREKLTQGRSGLLPQIGAAWSSTRTMFEQTAPADFNKTFSSTGWTLSLSQPLFRWDR
WETYKQGEIAAAAVEASLAQAQQDLITRTAQTYFDVLNAQDTLQLVLAQRDAIQQQYDQA
RRNFEVGNANITDANDAQARRDAIDATVIAARSDFEVKQSALKQITGEPVGKLAGVRTGV
ALPQPEPAAPERWVEQARGGNPQVALAQYNLQNAERDVKKASAGHLPSVDLVAQTGHTNA
SGNQYLPSLPGGARFDSSQIGVQVSIPIYAGGAIQSRVRESIALETKAASDLEYARRAVE
QGARQAYIGVIAGLAQVKALEAAEVSARTAYDSNQLAYGVGVRIGTDVLNAQAQLFSARR
DLARARYDTIVNGLRLKSAAGSLSEADVVQINTLLTANASEDLTTLPRPAARAKSSIPSA
NAKR