Protein Info for RPSI07_RS20345 in Ralstonia solanacearum PSI07

Annotation: prepilin-type N-terminal cleavage/methylation domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 331 transmembrane" amino acids 20 to 40 (21 residues), see Phobius details PF07963: N_methyl" amino acids 10 to 34 (25 residues), 29.7 bits, see alignment (E = 3.3e-11) TIGR02532: prepilin-type N-terminal cleavage/methylation domain" amino acids 13 to 34 (22 residues), 20.6 bits, see alignment (E = 1.4e-08) PF16074: PilW" amino acids 181 to 319 (139 residues), 109.4 bits, see alignment E=1.3e-35

Best Hits

KEGG orthology group: K02672, type IV pilus assembly protein PilW (inferred from 100% identity to rsl:RPSI07_2612)

Predicted SEED Role

"Type IV fimbrial biogenesis protein PilW" in subsystem Type IV pilus

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (331 amino acids)

>RPSI07_RS20345 prepilin-type N-terminal cleavage/methylation domain-containing protein (Ralstonia solanacearum PSI07)
MRTIRRIRSRRARGFSLVELMVALVIALLVLGATVSFYLLTRSTYTTIEDTSGLEERGQF
ALNVMTRVLRQAGFTKMTNDHSGGVMQLQPSDPPMVSGLDGCMSTEAAPKATGPAAGESL
SNCLSPQTPTGSDAIEVRFFGVGTTADLATPDGTIIDCSGQGVADYTTSDLAASQRGLSM
FFIQTGRDGNPYLACKFRKRDASGHEVTNTTNEDDFVTQQLVPGVETLQFLYGISTNKDT
VPDVYKRASDMTADDWKQVFAIKVAMVVRADNASADTHVDAPTYTLFGNQYTTADGTFKP
TQKLNVARRLFTTTVQVRNYLVCKEGTSQCQ