Protein Info for RPSI07_RS20035 in Ralstonia solanacearum PSI07

Annotation: glutamine--tRNA ligase/YqeY domain fusion protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 579 PF00749: tRNA-synt_1c" amino acids 44 to 362 (319 residues), 355.8 bits, see alignment E=2.7e-110 TIGR00440: glutamine--tRNA ligase" amino acids 45 to 579 (535 residues), 742.6 bits, see alignment E=1.5e-227 PF03950: tRNA-synt_1c_C" amino acids 365 to 463 (99 residues), 94.4 bits, see alignment E=6e-31 PF20974: tRNA-synt_1c_C2" amino acids 484 to 556 (73 residues), 89.2 bits, see alignment E=3.3e-29

Best Hits

Swiss-Prot: 96% identical to SYQ_RALSO: Glutamine--tRNA ligase (glnS) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K01886, glutaminyl-tRNA synthetase [EC: 6.1.1.18] (inferred from 100% identity to rsl:RPSI07_2551)

Predicted SEED Role

"Glutaminyl-tRNA synthetase (EC 6.1.1.18)" in subsystem tRNA aminoacylation, Glu and Gln (EC 6.1.1.18)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.1.1.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (579 amino acids)

>RPSI07_RS20035 glutamine--tRNA ligase/YqeY domain fusion protein (Ralstonia solanacearum PSI07)
MSQDNATGAAASTSNFLRQIIDADLGQGIYAGRQDTTGHALPPIITRFPPEPNGYLHIGH
AKSIWVNFGLAKEYGGRCHLRFDDTNPVKEDTEYVNSIIDAVHWLGYSWQNGTGEHLYYA
SDYFEQLYGFAEVLIQRGVAYVDSQSAEQIAAARGDFTRPGTPSPFRDRAVEENLALFRD
MRAGKYQDGQHVLRAKIDMAAPNIVMRDPVLYRIRHAHHHRTGDAWCIYPMYDFTHCISD
ALENITHSLCTLEFENNRPLYDWVLDHLRDAGALPAPLPHQYEFARLHLTYAITSKRKLL
QLVNEKRVDGWDDPRMPTLVGIRRRGYTPESIQLFCERVGVSKADSWIDMSILEAAVRDD
LDARAPRSVAVLDPVKLILDNVPADFNEPCSAPVHPKQPELGRREFPLTRELWIEREDFT
ETPPKGYFRLFPGNKVRLRYGYVIECTGCDKDADGNITAVHASIIPDTKSGTPGADSVKV
KGNIHWVSAAHALKAEVRLYDRLFSDPQPDSGDKNFLDALNPDSKQVVAAYLEPTLATAK
PEDRFQFERHGYFVADRIDSQPGKPVFNRVVGLKDSWGK